PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G120900.1
Common NameB456_009G120900, LOC105768393
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 486aa    MW: 53080.5 Da    PI: 6.3446
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G120900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.75.6e-33254308155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLHe+Fveav++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYRl
  Gorai.009G120900.1 254 KPRMRWTPELHECFVEAVSKLDGPEKATPKGVLKLMNVEGLTIYHVKSHLQKYRL 308
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.456251311IPR017930Myb domain
SuperFamilySSF466899.14E-18252308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-31253309IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-25254309IPR006447Myb domain, plants
PfamPF002494.1E-9256307IPR001005SANT/Myb domain
PfamPF143792.6E-20344391IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MKVGISSKTI NHPSFVSVTQ SDPSKGIGES YPIAVSPIHN FPSRDLEGPS WLTGECSSLF  60
PLKKNELNSG PSSPSSPSSH AKGAFSHSSV FCTSLYLSSS STSETQRQLG NFPFLPHPPT  120
CHQFISAVDS SKSPVVFTED LCNPYDVDHS EVIMKDFHKF PGDARDDGCF HGMHCERDNF  180
ILTEQVELHF LSDELDIAIN DHGENPRVEE ICESPQPSSK PTVGLTCNRN SASATPSMSA  240
AVSPALSGPA AVHKPRMRWT PELHECFVEA VSKLDGPEKA TPKGVLKLMN VEGLTIYHVK  300
SHLQKYRLAK YMPEKKEEKK TWSSGEKKAA LSIGESDGKK NGGMHITEAL QMQIEVQKQL  360
HEQLELQRLL QLRIEEQARY LQKILEEQQK AGSALIPTLS LSAPTDPPSQ NSELQQPSSP  420
SAVVSASQHS ESKTESSSAS SLPSKHKANG VGVNECKTES SLKRFRFEDK PESAIDEAVV  480
ENPVQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443746.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_012443747.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_012443748.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A0D2TNZ60.0A0A0D2TNZ6_G
STRINGPOPTR_0007s15110.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.25e-93G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]